FOXO4-DRI vendor/2460055-10-9/Peptide research and development

Basic information:

PeptideName:FOXO4-DRI vendor/2460055-10-9/Peptide research and development

Catalog No:GT-M144

Sequence:ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg(all D-AA, D型Ile用D-ALLO-Ile) 

CAS Number:2460055-10-9

Molecular Formula:C228H388N86O64

Molecular Weight:5358.06

Category:FOXO4-DRI vendorPharmaceutical Peptide、Custom peptide、Polypeptide synthesisPeptide research and development


Product Detail

Description

FOXO4-DRI is a cytoosmotic peptide antagonist, a pharmacological peptide that binds competitively to p53, blocks the interaction of FOXO4 and p53, and pushes senescent cells into the apoptotic process, thus ameliorating the side effect of aging and chemotherapy.

 

Specifications

Apperance: White to off-white powder

Purity(HPLC): 98.0%

Single Impurity: 2.0%

Acetate Content(HPLC): 5.0%12.0%

Water Content (Karl Fischer): 10.0%

Peptide Content: 80.0%

Packing and Shipping: Low temperature, vacuum packing, accurate to mg as required.

 

FAQ

How To Order?

1. Contact us directly by phone or email: +86-13735575465, sales1@gotopbio.com.

2. Order online. Please fill out the order online form.

3. Provide peptide name, CAS No. or sequence, purity and modification if required, quantity, etc. we will provide a quotation within 2 hours.

4. Order conformation by duly signed sales contract and NDA(non disclosure agreement) or confidential agreement.

5. We will continuously update the order progress in time.

6. Peptide delivery by DHL, Fedex or others, and HPLC, MS, COA will be provided along with the cargo.

7. Refund policy will be followed if any discrepancy of our quality or service.

8. After-sale service: If our clients have any questions about our peptide during experiment, please feel free to contact us and we will respond to it in a short time.

All products of the company are only used for scientific research purpose, its prohibited to be directly used by any individuals on human body.

If you want to do a biotin modification at the N terminal, do you need to put a gap between the biotin and the peptide sequence?

The standard biotin labeling procedure used by our company is to attach an Ahx to the peptide chain, followed by biotin. Ahx is a 6-carbon compound that acts as a barrier between the peptide and the biotin.

What do I need to pay attention to when introducing fluorescent modifications into peptides?
It is recommended to add a linker between the peptide molecule and the fluorescent modification, which can reduce the effect of the fluorescent modification on the peptide folding and binding to the receptor. However, if the purpose of the fluorescence modification is to quantify the fluorescence migration between different structures, the introduction of a linker is not recommended.

Why should peptides be modified by N-terminal acetylation and C-terminal amidation?
Such modifications can give peptide sequences properties that are native to proteins.

How pure can the peptide be?

Our company can provide different purity levels for customers to choose from, from crude to > 99.9% purity. According to customer needs we can provide purity > 99.9% ultra-pure polypeptide.


  • Previous:
  • Next: