Customization of High Purity vosoritide

Basic information:

PeptideName:Vosoritide

Catalog No:GT-P488

Sequence:PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39)

CAS Number:1480724-61-5

Molecular Formula:C176H290N56O51S3

Molecular Weight:4102.77

Category:Vosoritide supplierPharmaceutical Peptide、Peptide customization、Peptide supplier、Amino Acid analysis


Product Detail

Description

Vosoritide is a modified recombinant CNP (C-type natriuretic peptide) analog that binds to NPR-B (natriuretic peptide receptor B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in research on chondropathy and dwarfism.

 4969bdfd829455a85d76fb5e0eebcf74(1)

Specifications

Apperance: White to off-white powder

Purity(HPLC): ≥98.0%

Single Impurity: ≤2.0%

Acetate Content(HPLC): 5.0%~12.0%

Water Content (Karl Fischer): ≤10.0%

Peptide Content: ≥80.0%

Packing and Shipping: Low temperature, vacuum packing, accurate to mg as required.

 7fe4a04fc67d1438b4b454c57ab1ad6b(1)

FAQ

What is the direction of peptide synthesis?

Peptide synthesis starts from the C-terminus to the N-terminus of the peptide.
What packaging is used for my goods?

We usually use bottles made of PP material for packaging, and then cover the bottles with a layer of aluminum foil bags.
What do I need to pay attention to when introducing fluorescent modifications into peptides?
It is recommended to add a linker between the peptide molecule and the fluorescent modification, which can reduce the effect of the fluorescent modification on the peptide folding and binding to the receptor. However, if the purpose of the fluorescence modification is to quantify the fluorescence migration between different structures, the introduction of a linker is not recommended.
How pure can the peptide be?

Our company can provide different purity levels for customers to choose from, from crude to > 99.9% purity. According to customer needs we can provide purity > 99.9% ultra-pure polypeptide.


  • Previous:
  • Next: